| Basic Information | |
|---|---|
| Taxon OID | 3300003614 Open in IMG/M |
| Scaffold ID | JGI20129J51890_10345627 Open in IMG/M |
| Source Dataset Name | Hypoxic/sulfidic aquatic microbial communities from Monarch Geyser, Yellowstone National Park, USA - MG |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 927 |
| Total Scaffold Genes | 2 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (50.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| Not Available | (Source: ) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Non-Marine Saline And Alkaline → Unclassified → Unclassified → Hypoxic/Sulfidic Aquatic → Saline, Thermophilic Phototrophic And Chemotrophic Mat Microbial Communities From Various Locations In Usa And Mexico |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Monarch Geyser, Yellowstone National Park, Wyoming, USA | |||||||
| Coordinates | Lat. (o) | 44.376 | Long. (o) | -110.69 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F022018 | Metagenome / Metatranscriptome | 216 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| JGI20129J51890_103456272 | F022018 | GAG | MAEAEDVVGMVMEGYGIYLRQVSETPWADAMASVEYLEDFEDLNDSDLIDVLARWAGRSYKDFKRVWEGLSDKEKERALGEIEYEIAVIGFESLLKGIAADFDVMENKDIRERIINAAKRYLNGEIDFYDLAEELENIFWPTEEDKKKYEEGLRHFWDGIGLTDYIEENEVKEMVNRYLIEELEAIGKTSDLGEPGP* |
| ⦗Top⦘ |