Scaffold JGI26462J51802_1010521

Overview

Basic Information

• Taxon OID: 3300003606
• Scaffold ID: JGI26462J51802_1010521
• Source Dataset Name: Freshwater microbial communities from Yellowstone National Park, Wyoming, USA - Fairy Falls B (FF_Mn_B) MetaG
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 1896
• Total Scaffold Genes: 4
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 1 (25.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Freshwater → Lotic → Unclassified → Freshwater → Saline, Thermophilic Phototrophic And Chemotrophic Mat Microbial Communities From Various Locations In Usa And Mexico

Source Dataset Sampling Location

• Location Name: Yellowstone National Park, Wyoming, USA
• Coordinates
  • Lat. (^o): 44.376
  • Long. (^o): -110.69

Associated Families

Family	Category	Number of Sequences	3D Structure?
F028182	Metagenome / Metatranscriptome	192	N

Sequences

Protein ID	Family	RBS	Sequence
JGI26462J51802_10105213	F028182	N/A	MPKVSISEAARRLDTTEEVIREWIRLGLPDVELPSAKPRRTRELNPAFQPTSATPEPKVDLEQLYEVADQVGWFLLSMEAWDMADAETACQLSHTGTIPPP*