NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold JGI26382J51730_1036501

Scaffold JGI26382J51730_1036501


Overview

Basic Information
Taxon OID3300003601 Open in IMG/M
Scaffold IDJGI26382J51730_1036501 Open in IMG/M
Source Dataset NameMarine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - SI074_LV_165m_DNA
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1148
Total Scaffold Genes3 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)2 (66.67%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Associated Families2

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Intertidal Zone → Unclassified → Marine → Marine Microbial Communities From Expanding Oxygen Minimum Zones In The Northeastern Subarctic Pacific Ocean

Source Dataset Sampling Location
Location NameSaanich Inlet, British Columbia, Canada
CoordinatesLat. (o)48.6Long. (o)-123.5Alt. (m)Depth (m)125
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F033216Metagenome / Metatranscriptome178N
F066127Metagenome127N

Sequences

Protein IDFamilyRBSSequence
JGI26382J51730_10365011F033216N/AMAISNVKVVNTASKYIVKSKGIGSETNQVLVNANDLTGGTNKSLVSLIECYYIIESIGSTEGKLTISAAVDAEYDEQAEAAGTQVRKDLVLTGNGKYGLRPSQLKFGNDKIFKLTTDSNVRNYLLVTEFRR
JGI26382J51730_10365013F066127GAGGVSEISFKSXTGKLVERKTSLPTTQFNKLSPKMKAAITDMYAMINKASDPLISKIEGIVKAVSKKHGVSVYDIEDYIDNELIK*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.