Scaffold Ga0007417J51691_1073375

Overview

Basic Information

• Taxon OID: 3300003544
• Scaffold ID: Ga0007417J51691_1073375
• Source Dataset Name: Grassland soil microbial communities from Hopland, California, USA - Sample H2_Rhizo_33 (Metagenome Metatranscriptome, Counting Only)
• Source Dataset Category: Metatranscriptome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 1685
• Total Scaffold Genes: 2
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 1 (50.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → Viruses → Riboviria → Orthornavirae → Lenarviricota → Leviviricetes (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere → Avena Fatua Rhizosphere Microbial Communities From Hopland, California, Usa

Source Dataset Sampling Location

• Location Name: Hopland, California, USA
• Coordinates
  • Lat. (^o): 38.972988
  • Long. (^o): -123.116539

Associated Families

Family	Category	Number of Sequences	3D Structure?
F046763	Metagenome / Metatranscriptome	150	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0007417J51691_10733752	F046763	GAGG	MSLGTSQTLSKDSATDVDTNTVVYDLQAADAGQSSFSVAGITPPSAKLMSVSHQTGKSGEARHLVRLDRTEVDAFGVPATVSTYVVQVRPPNSALTNAICIEEVNRLVDFIIEGGTNANWTKILNNEC*