Basic Information | |
---|---|
Taxon OID | 3300003542 Open in IMG/M |
Scaffold ID | FS900DNA_10039249 Open in IMG/M |
Source Dataset Name | Diffuse hydrothermal flow volcanic vent microbial communities from Axial Seamount, northeast Pacific ocean - Sample FS900_Dependable_DNA |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 574 |
Total Scaffold Genes | 2 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (50.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → unclassified Myxococcales → Myxococcales bacterium | (Source: UniRef50) |
Source Dataset Ecosystem |
---|
Environmental → Aquatic → Marine → Hydrothermal Vents → Diffuse Flow → Diffuse Hydrothermal Flow Volcanic Vent → Diffuse Hydrothermal Flow Volcanic Vent Microbial Communities From Axial Seamount, Northeast Pacific Ocean |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | Axial seamount, northeast pacific ocean | |||||||
Coordinates | Lat. (o) | 45.87992 | Long. (o) | -129.80294 | Alt. (m) | Depth (m) | 1917 | Location on Map |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F002426 | Metagenome | 560 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
FS900DNA_100392491 | F002426 | GAG | MAGLQTRTYTLAGSSLTAGTFASISQLLGSSQSTTNPEGMNRVVRISMSCSPDHTSATDGVSVFKFAGDGVSVQQIFAGPSWSNQAAGPLDGNNGMPVVVENSAGIFDIIAGNQIDFSVSCTTAETVDVAVSITYAA* |
⦗Top⦘ |