| Basic Information | |
|---|---|
| Taxon OID | 3300003542 Open in IMG/M |
| Scaffold ID | FS900DNA_10021665 Open in IMG/M |
| Source Dataset Name | Diffuse hydrothermal flow volcanic vent microbial communities from Axial Seamount, northeast Pacific ocean - Sample FS900_Dependable_DNA |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 2083 |
| Total Scaffold Genes | 5 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 4 (80.00%) |
| Novel Protein Genes | 2 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 2 (100.00%) |
| Associated Families | 2 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium ADurb.BinA104 | (Source: UniRef50) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Marine → Hydrothermal Vents → Diffuse Flow → Diffuse Hydrothermal Flow Volcanic Vent → Diffuse Hydrothermal Flow Volcanic Vent Microbial Communities From Axial Seamount, Northeast Pacific Ocean |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Axial seamount, northeast pacific ocean | |||||||
| Coordinates | Lat. (o) | 45.87992 | Long. (o) | -129.80294 | Alt. (m) | Depth (m) | 1917 | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F035492 | Metagenome | 172 | N |
| F071659 | Metagenome | 122 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| FS900DNA_100216653 | F035492 | AGGAG | MADVGSILESKESQDSWYDPKKDFSGPMPEGEYKAHVKALNIKRNIVVKGKFLSDIYEVTFTVADENKDMEYQNDKGESLSGSAIVGRDFRSKGFFRFKKPNKSEYPNLSENMGSNRSYMELVSSFGLKMEEVDGKFYLPELDSSDIEGLPVIAKLYHDTWTDGDGEDRITPRASMIFDWEDGEKKEEELPF* |
| FS900DNA_100216655 | F071659 | GAG | MGWDAGIDAMCEAHREVAPKKPIYELSKREDKKLIFRLRKRYSKYKEGSN* |
| ⦗Top⦘ |