Scaffold FS896DNA_10603430

Overview

Basic Information

• Taxon OID: 3300003540
• Scaffold ID: FS896DNA_10603430
• Source Dataset Name: Diffuse hydrothermal flow volcanic vent microbial communities from Axial Seamount, northeast Pacific ocean - Sample FS896_ElGuapo_DNA
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 564
• Total Scaffold Genes: 1
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Rhizobiaceae → Shinella → unclassified Shinella → Shinella sp. DD12 (Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Hydrothermal Vents → Diffuse Flow → Diffuse Hydrothermal Flow Volcanic Vent → Diffuse Hydrothermal Flow Volcanic Vent Microbial Communities From Axial Seamount, Northeast Pacific Ocean

Source Dataset Sampling Location

• Location Name: Axial seamount, northeast pacific ocean
• Coordinates
  • Lat. (^o): 45.926575
  • Long. (^o): -129.979479
  • Depth (m): 1507

Associated Families

Family	Category	Number of Sequences	3D Structure?
F007391	Metagenome / Metatranscriptome	352	N

Sequences

Protein ID	Family	RBS	Sequence
FS896DNA_106034301	F007391	N/A	GGFNSLDPKNLIKTAATTAVTYAIAGPIPAVANLATSVAIDEVLPDDKPAISEIEEGNQEQMIAYIVQNLTTTVLYIIIGFLVFTNVVGPWAAQRRARRKAEGIALDQRRKDKYDTMKAELNARRNQE*