Scaffold FS896DNA_10264376

Overview

Basic Information

• Taxon OID: 3300003540
• Scaffold ID: FS896DNA_10264376
• Source Dataset Name: Diffuse hydrothermal flow volcanic vent microbial communities from Axial Seamount, northeast Pacific ocean - Sample FS896_ElGuapo_DNA
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 1325
• Total Scaffold Genes: 4
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 3 (75.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → Viruses → Predicted Viral (Source: DeepVirFinder)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Hydrothermal Vents → Diffuse Flow → Diffuse Hydrothermal Flow Volcanic Vent → Diffuse Hydrothermal Flow Volcanic Vent Microbial Communities From Axial Seamount, Northeast Pacific Ocean

Source Dataset Sampling Location

• Location Name: Axial seamount, northeast pacific ocean
• Coordinates
  • Lat. (^o): 45.926575
  • Long. (^o): -129.979479
  • Depth (m): 1507

Associated Families

Family	Category	Number of Sequences	3D Structure?
F049231	Metagenome / Metatranscriptome	147	Y

Sequences

Protein ID	Family	RBS	Sequence
FS896DNA_102643762	F049231	AGTAGG	MIPYEVHLDDWTVALYATDDGRLTFTVTNSSDPKDYLTRVVGEVRLRRYYIGRQCAGELHATPFPTYRDAKPTSKEALMAAEGAG*