| Basic Information | |
|---|---|
| Taxon OID | 3300003539 Open in IMG/M |
| Scaffold ID | FS891DNA_10267378 Open in IMG/M |
| Source Dataset Name | Diffuse hydrothermal flow volcanic vent microbial communities from Axial Seamount, northeast Pacific ocean - Sample FS891_Anemone_DNA |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 1189 |
| Total Scaffold Genes | 2 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (50.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| Not Available | (Source: ) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Marine → Hydrothermal Vents → Diffuse Flow → Diffuse Hydrothermal Flow Volcanic Vent → Diffuse Hydrothermal Flow Volcanic Vent Microbial Communities From Axial Seamount, Northeast Pacific Ocean |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Axial seamount, northeast pacific ocean | |||||||
| Coordinates | Lat. (o) | 45.933231 | Long. (o) | -130.013645 | Alt. (m) | Depth (m) | 1542 | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F061918 | Metagenome | 131 | N |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| FS891DNA_102673781 | F061918 | N/A | LLMQYFQVKQSTKTNKTKRKRNMSIETYAERLQKRKRGKMSNYDMDEIERERDRNSFASVKIGDASEKPEAVVTVELPDKVILKLALQAHERDITLNKMCGIALKDSLKNLEYRYEHQSKPQVLKEY* |
| ⦗Top⦘ |