Scaffold FS891DNA_10019198

Overview

Basic Information

• Taxon OID: 3300003539
• Scaffold ID: FS891DNA_10019198
• Source Dataset Name: Diffuse hydrothermal flow volcanic vent microbial communities from Axial Seamount, northeast Pacific ocean - Sample FS891_Anemone_DNA
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 1564
• Total Scaffold Genes: 3
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 2 (66.67%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → Viruses → Predicted Viral (Source: DeepVirFinder)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Hydrothermal Vents → Diffuse Flow → Diffuse Hydrothermal Flow Volcanic Vent → Diffuse Hydrothermal Flow Volcanic Vent Microbial Communities From Axial Seamount, Northeast Pacific Ocean

Source Dataset Sampling Location

• Location Name: Axial seamount, northeast pacific ocean
• Coordinates
  • Lat. (^o): 45.933231
  • Long. (^o): -130.013645
  • Depth (m): 1542

Associated Families

Family	Category	Number of Sequences	3D Structure?
F025055	Metagenome	203	Y

Sequences

Protein ID	Family	RBS	Sequence
FS891DNA_100191982	F025055	AGTAG	MSYFRNSVGDKKIIKATYSDSQMIEVLGGTVKKIFNYEEEDNVTFLKNEVFWLNYLKSKWVPELLEVGKNYVITSYYGPDLTKVHHLSRPKDLANQTLEMYRFFKDKNVFKLNGALRNMTLNKGQLVAFDFKHARFRTNKYIDYEIVSYEKWLSKIDNELVEKLKLLI*