NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold FS891DNA_10002115

Scaffold FS891DNA_10002115


Overview

Basic Information
Taxon OID3300003539 Open in IMG/M
Scaffold IDFS891DNA_10002115 Open in IMG/M
Source Dataset NameDiffuse hydrothermal flow volcanic vent microbial communities from Axial Seamount, northeast Pacific ocean - Sample FS891_Anemone_DNA
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing Center
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)3926
Total Scaffold Genes8 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)4 (50.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (100.00%)
Associated Families1

Taxonomy
All Organisms → cellular organisms → Bacteria → FCB group → Candidatus Marinimicrobia → Marinimicrobia bacterium SCGC AAA003-L08(Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Hydrothermal Vents → Diffuse Flow → Diffuse Hydrothermal Flow Volcanic Vent → Diffuse Hydrothermal Flow Volcanic Vent Microbial Communities From Axial Seamount, Northeast Pacific Ocean

Source Dataset Sampling Location
Location NameAxial seamount, northeast pacific ocean
CoordinatesLat. (o)45.933231Long. (o)-130.013645Alt. (m)Depth (m)1542
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F095626Metagenome / Metatranscriptome105N

Sequences

Protein IDFamilyRBSSequence
FS891DNA_100021156F095626AGGLGRTTNAQPIALSTIIDLNMDLQRRLKRLRCTAFPYFLDTINPISALELLLYLNDKSLKYRDFEAFIILENADEESECFN*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.