| Basic Information | |
|---|---|
| Taxon OID | 3300003528 Open in IMG/M |
| Scaffold ID | LVWS2TP113H_100379 Open in IMG/M |
| Source Dataset Name | Diffuse hydrothermal flow volcanic vent microbial communities from Axial Seamount, northeast Pacific ocean - Sample LVWS2_TP1_13H |
| Source Dataset Category | Metatranscriptome |
| Source Dataset Use Policy | Open |
| Sequencing Center | |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 702 |
| Total Scaffold Genes | 2 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (50.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| Not Available | (Source: ) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Marine → Oceanic → Aphotic Zone → Background Seawater → Diffuse Hydrothermal Flow Volcanic Vent Microbial Communities From Axial Seamount, Northeast Pacific Ocean |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Axial seamount, northeast pacific ocean | |||||||
| Coordinates | Lat. (o) | 45.933251 | Long. (o) | -130.01379 | Alt. (m) | Depth (m) | 1542 | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F082613 | Metagenome / Metatranscriptome | 113 | N |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| LVWS2TP113H_1003791 | F082613 | N/A | QQSVVVAGLNATTKDAGIYATKIISVTTSASASNILIGHTNVGFAPWKVIPSRGVSSTTGASIGIDGTANITLQTTFANIADNAIFAGTFDVFSHSFLAALTASAFDTVDAREIGVRLKFNSWSSGNVRLDLSVSAKG* |
| ⦗Top⦘ |