| Basic Information | |
|---|---|
| Taxon OID | 3300003523 Open in IMG/M |
| Scaffold ID | DRAFT_10415418 Open in IMG/M |
| Source Dataset Name | Camel rumen microbial communities from Jandagh-Isfahan, Iran - Sample 1 |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | Beijing Genomics Institute (BGI) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 768 |
| Total Scaffold Genes | 1 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| Not Available | (Source: ) |
| Source Dataset Ecosystem |
|---|
| Host-Associated → Mammals → Digestive System → Foregut → Rumen → Camel Rumen → Camel Rumen Microbial Communities From Jandagh-Isfahan, Iran |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Jandaq, Isfahan Province, Iran | |||||||
| Coordinates | Lat. (o) | 34.041281 | Long. (o) | 54.414582 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F076635 | Metagenome / Metatranscriptome | 118 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| DRAFT_104154181 | F076635 | AGGAGG | MIKRGSKVSVVKMDTAGGMDWQAKRLEGKVFTVRFIDSAGQIHLEETGIALLPVSMNMRL |
| ⦗Top⦘ |