Basic Information | |
---|---|
Taxon OID | 3300003514 Open in IMG/M |
Scaffold ID | FS821DNA_1101696 Open in IMG/M |
Source Dataset Name | Diffuse hydrothermal flow volcanic vent microbial communities from Axial Seamount, northeast Pacific ocean - Sample FS821_Marshmallow_DNA |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 568 |
Total Scaffold Genes | 2 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (50.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
Not Available | (Source: ) |
Source Dataset Ecosystem |
---|
Environmental → Aquatic → Marine → Hydrothermal Vents → Diffuse Flow → Diffuse Hydrothermal Flow Volcanic Vent → Diffuse Hydrothermal Flow Volcanic Vent Microbial Communities From Axial Seamount, Northeast Pacific Ocean |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | Axial seamount, northeast pacific ocean | |||||||
Coordinates | Lat. (o) | 45.934 | Long. (o) | -130.013428 | Alt. (m) | Depth (m) | 1544 | Location on Map |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F025144 | Metagenome | 203 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
FS821DNA_11016962 | F025144 | N/A | MKKNIKKVFKKLDPELQEAVKFLINDIQVKREIKKLEKSEKKP* |
⦗Top⦘ |