Scaffold FS821DNA_1025703

Overview

Basic Information

• Taxon OID: 3300003514
• Scaffold ID: FS821DNA_1025703
• Source Dataset Name: Diffuse hydrothermal flow volcanic vent microbial communities from Axial Seamount, northeast Pacific ocean - Sample FS821_Marshmallow_DNA
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 597
• Total Scaffold Genes: 2
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 2 (100.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: Not Available (Source: )

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Hydrothermal Vents → Diffuse Flow → Diffuse Hydrothermal Flow Volcanic Vent → Diffuse Hydrothermal Flow Volcanic Vent Microbial Communities From Axial Seamount, Northeast Pacific Ocean

Source Dataset Sampling Location

• Location Name: Axial seamount, northeast pacific ocean
• Coordinates
  • Lat. (^o): 45.934
  • Long. (^o): -130.013428
  • Depth (m): 1544

Associated Families

Family	Category	Number of Sequences	3D Structure?
F033078	Metagenome	178	Y

Sequences

Protein ID	Family	RBS	Sequence
FS821DNA_10257031	F033078	GAGG	MSNEKTIKALPEYLQPKILSAVAYVNECAPNLNKAVERINTIREHFTDKEVMWVMSLLTFEKLLDMVKDS