Scaffold SACTD2sed_1000656

Overview

Basic Information

• Taxon OID: 3300003512
• Scaffold ID: SACTD2sed_1000656
• Source Dataset Name: Macrotidal river microbial communities from the South Alligator River system, Northern Australia - Sample CTD2 sed R1
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 49238
• Total Scaffold Genes: 59
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 50 (84.75%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: Not Available (Source: )

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Freshwater → Lotic → Unclassified → Macrotidal River → Macrotidal River Microbial Communities From The South Alligator River System, Northern Australia

Source Dataset Sampling Location

• Location Name: River
• Coordinates
  • Lat. (^o): -12.2376
  • Long. (^o): 132.4096

Associated Families

Family	Category	Number of Sequences	3D Structure?
F077052	Metagenome / Metatranscriptome	117	Y

Sequences

Protein ID	Family	RBS	Sequence
SACTD2sed_100065615	F077052	GAG	MPSIVFNYGSWWNWEDYPGQKVAFDSFTKIIYVAEGVTELDVKIDVYSAWKEWVINSPQYPLPAAWDKAITAIGGEPLTDILNVGTTFFLENGWRIQPFASKTPYVLTVNGNLYTREAGENPFLFAEGVSVNLSRSNLVDQVVATASLTTEDLLSIASYVWSQSSFGSPNGSYGALVNRIDSDVSSLDINRLNKALTKGEFLALK*