| Basic Information | |
|---|---|
| Taxon OID | 3300003512 Open in IMG/M |
| Scaffold ID | SACTD2sed_1000421 Open in IMG/M |
| Source Dataset Name | Macrotidal river microbial communities from the South Alligator River system, Northern Australia - Sample CTD2 sed R1 |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 4775 |
| Total Scaffold Genes | 19 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 3 (15.79%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → Viruses → Predicted Viral | (Source: DeepVirFinder) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Freshwater → Lotic → Unclassified → Macrotidal River → Macrotidal River Microbial Communities From The South Alligator River System, Northern Australia |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | River | |||||||
| Coordinates | Lat. (o) | -12.2376 | Long. (o) | 132.4096 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F005478 | Metagenome / Metatranscriptome | 399 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| SACTD2sed_10004216 | F005478 | GAG | MYDDYDLDYTFYNDYNLDEDTYYEYHAQSDVDLDEDYARGELDYSNLAYRHYA* |
| ⦗Top⦘ |