Basic Information | |
---|---|
Taxon OID | 3300003510 Open in IMG/M |
Scaffold ID | FS857DNA_1039714 Open in IMG/M |
Source Dataset Name | Diffuse hydrothermal flow volcanic vent microbial communities from Axial Seamount, northeast Pacific ocean - Sample FS857_Anemone_DNA |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 751 |
Total Scaffold Genes | 2 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (50.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
Not Available | (Source: ) |
Source Dataset Ecosystem |
---|
Environmental → Aquatic → Marine → Hydrothermal Vents → Diffuse Flow → Diffuse Hydrothermal Flow Volcanic Vent → Diffuse Hydrothermal Flow Volcanic Vent Microbial Communities From Axial Seamount, Northeast Pacific Ocean |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | Axial seamount, northeast pacific ocean | |||||||
Coordinates | Lat. (o) | 45.933 | Long. (o) | -130.01379 | Alt. (m) | Depth (m) | 1543 | Location on Map |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F013358 | Metagenome / Metatranscriptome | 272 | N |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
FS857DNA_10397141 | F013358 | AGG | MSVRPKSVCDSCSATYIIIHELPEDMYTEQYCPFCGEEHEDIEEDDLLNEDWD* |
⦗Top⦘ |