NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold JGIcombinedJ51221_10069290

Scaffold JGIcombinedJ51221_10069290


Overview

Basic Information
Taxon OID3300003505 Open in IMG/M
Scaffold IDJGIcombinedJ51221_10069290 Open in IMG/M
Source Dataset NameForest soil microbial communities from Harvard Forest LTER, USA - Combined assembly of forest soil metaG samples (ASSEMBLY_DATE=20140924)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1372
Total Scaffold Genes3 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)2 (66.67%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (66.67%)
Associated Families3

Taxonomy
All Organisms → cellular organisms → Bacteria(Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil → Forest Soil Microbial Communities From Harvard Forest Long Term Ecological Research (Lter) Site In Petersham, Ma, For Long-Term Soil Warming Studies

Source Dataset Sampling Location
Location NameHarvard Forest LTER, Petersham, MA, USA
CoordinatesLat. (o)42.53312Long. (o)-72.189707Alt. (m)Depth (m)0 to .1
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F006575Metagenome / Metatranscriptome370Y
F007126Metagenome / Metatranscriptome357Y
F012935Metagenome / Metatranscriptome276Y

Sequences

Protein IDFamilyRBSSequence
JGIcombinedJ51221_100692901F007126AGGAGMAGVINDIEALAEFRAHLMRFNHDLAENFATIQSHWRELGEVWRDDMYRLFGEALEEVTPGITQYLSATEGHEAH
JGIcombinedJ51221_100692902F006575GGAGMTEQERAMAAAMATSPYLSLRQAVRPAILAHWLLAGDQERAGKLAAECEDLLVLTRELLKAAGRARILAEPAPSAQIPDSQESGGDRHAQFLDAYADAGLLWAKVVGCSVALAQALIGRGEWDDVRRLADFLAGAGEESAAADLRIQLGKAVFQTHSEQLRGISNTMPPXXVGEAINALRAVLRDVPEEFPDRNREVXRFLAPLASAIHAIMKDQXIDIPLTSRVEHIATGGVAKYPDIVKISLDELAAEFEGACS*
JGIcombinedJ51221_100692903F012935N/ADYGRPSELSARLVRLADKGPDAGIHVVAWTDGYTTAERALRRAGIGFFGLRAVLRVLSPAESDSLLGVSAAASLDDDRALYRDTEWPAEQVEKFKPYSIASLSAFAQEFFGRPA*
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.