Scaffold JGI25930J51415_1001057

Overview

Basic Information

• Taxon OID: 3300003499
• Scaffold ID: JGI25930J51415_1001057
• Source Dataset Name: Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MLB.DN
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 6250
• Total Scaffold Genes: 7
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 4 (57.14%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria (Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake → Freshwater Lake Microbial Communities From The Great Lakes, Usa, Analyzing Microbial Food Webs And Carbon Cycling

Source Dataset Sampling Location

• Location Name: Lake Michigan, USA
• Coordinates
  • Lat. (^o): 43.1998
  • Long. (^o): -86.5698

Associated Families

Family	Category	Number of Sequences	3D Structure?
F057315	Metagenome / Metatranscriptome	136	N

Sequences

Protein ID	Family	RBS	Sequence
JGI25930J51415_10010573	F057315	N/A	MVYRRSYRKYSNRFYWLDRVEGTMGIDEIDLDTPNEFQHIHEQNNVGRLRLIVELT*