Scaffold JGI26531J51214_10020463

Overview

Basic Information

• Taxon OID: 3300003486
• Scaffold ID: JGI26531J51214_10020463
• Source Dataset Name: Wastewater bioreactor microbial communities from Cape Town, South Africa - Thiocy_cont_500_biof
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 2757
• Total Scaffold Genes: 6
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 1 (16.67%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria (Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem: Engineered → Bioremediation → Hydrocarbon → Unclassified → Unclassified → Wastewater Bioreactor → Wastewater Bioreactor Microbial Communities From Cape Town, South Africa

Source Dataset Sampling Location

• Location Name: South Africa: Cape Town
• Coordinates
  • Lat. (^o): -33.927
  • Long. (^o): 18.452665

Associated Families

Family	Category	Number of Sequences	3D Structure?
F077495	Metagenome / Metatranscriptome	117	Y

Sequences

Protein ID	Family	RBS	Sequence
JGI26531J51214_100204636	F077495	N/A	MYSNRNIILLIGLTLASVSSILVQLDLFQNSLSSTSVVTVKADTVDDEQHLVANTDEDNSISNEVDDELEFYRRASLRPVALYQRASLRPFAGKRASLRPFAGKRASLRPFAGKRASLRPVNYMGKRKRRSLMYVDSE*