Scaffold nap3_10141898

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold nap3_10141898

Scaffold nap3_10141898

Overview

Basic Information
Taxon OID	3300003477 Open in IMG/M
Scaffold ID	nap3_10141898 Open in IMG/M
Source Dataset Name	Estuarine microbial communities from the Sarno estuary, Gulf of Naples, Italy - Sample Station 3
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	582
Total Scaffold Genes	1 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Associated Families	1

Taxonomy
Not Available	(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Estuarine → Estuary Microbial Community From Gulf Of Naples, Italy

Source Dataset Sampling Location
Location Name	Gulf of Naples
Coordinates	Lat. (^o)	40.7255	Long. (^o)	14.44767	Alt. (m)		Depth (m)	0
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F009243	Metagenome / Metatranscriptome	321	Y

Sequences

Protein ID	Family	RBS	Sequence
nap3_101418981	F009243	N/A	YYNDEQYHGGHNQVVDPNLMEEKWLREINFIQQMEMKYPQHVPEIQDIDFINKKLYLKIDGPDMWELAGCEGNDYSVVDNWEEQMLEIIQAHKDLGLYKYSMHPSSYFVVEGKLKSINYFFTYSDQDLCISLRSVMSHISEDRQADLFPKMEAAGIDVNKDTPHSQIQLLAFDSFKTNFPDEVMEKAKAIYA*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.