| Basic Information | |
|---|---|
| Taxon OID | 3300003477 Open in IMG/M |
| Scaffold ID | nap3_10118503 Open in IMG/M |
| Source Dataset Name | Estuarine microbial communities from the Sarno estuary, Gulf of Naples, Italy - Sample Station 3 |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 635 |
| Total Scaffold Genes | 1 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Gammaproteobacteria incertae sedis → SAR86 cluster → SAR86 cluster bacterium | (Source: UniRef50) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Estuarine → Estuary Microbial Community From Gulf Of Naples, Italy |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Gulf of Naples | |||||||
| Coordinates | Lat. (o) | 40.7255 | Long. (o) | 14.44767 | Alt. (m) | Depth (m) | 0 | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F058738 | Metagenome / Metatranscriptome | 134 | N |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| nap3_101185031 | F058738 | N/A | MKNKLNLIEDLILSELRVFNMMQFFRGFITDTESRLIVYEVYCRDRDNAEPINVKWVEQQLEVSFPTAFKIIEKLINEGFLKKSRGAKDKRSYTLHPTNALKEGIKTYTMMWLEKAIELDLIQMNDEEKKELYKHVKIKVGAVK |
| ⦗Top⦘ |