Scaffold nap3_10000271

Overview

Basic Information

• Taxon OID: 3300003477
• Scaffold ID: nap3_10000271
• Source Dataset Name: Estuarine microbial communities from the Sarno estuary, Gulf of Naples, Italy - Sample Station 3
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 9304
• Total Scaffold Genes: 23
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 8 (34.78%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Estuarine → Estuary Microbial Community From Gulf Of Naples, Italy

Source Dataset Sampling Location

• Location Name: Gulf of Naples
• Coordinates
  • Lat. (^o): 40.7255
  • Long. (^o): 14.44767
  • Depth (m): 0

Associated Families

Family	Category	Number of Sequences	3D Structure?
F048843	Metagenome / Metatranscriptome	147	Y

Sequences

Protein ID	Family	RBS	Sequence
nap3_1000027123	F048843	N/A	ILKMKTQKKKDKYFVFSVPTAFVYEIQAETEQEAREILVEEGGLSIFGEQCDMTSEDYAQADLEQTYEM*