Scaffold NAP2_1156959

Overview

Basic Information

• Taxon OID: 3300003476
• Scaffold ID: NAP2_1156959
• Source Dataset Name: Estuarine microbial communities from the Sarno estuary, Gulf of Naples, Italy - Sample Station 2
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 514
• Total Scaffold Genes: 1
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Rikenellaceae → Alistipes → Alistipes senegalensis (Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Estuarine → Estuary Microbial Community From Gulf Of Naples, Italy

Source Dataset Sampling Location

• Location Name: Gulf of Naples
• Coordinates
  • Lat. (^o): 40.725
  • Long. (^o): 14.39983
  • Depth (m): 0

Associated Families

Family	Category	Number of Sequences	3D Structure?
F026404	Metagenome	198	N

Sequences

Protein ID	Family	RBS	Sequence
NAP2_11569591	F026404	AGGA	MTIYGKTLEIKNITEGYTKEQIEQNIEQFTEDRNEALYDLYEMKRETLAFNEGGNKYGYLELIDDTDFFTPEDFTDTYNVKGFTDEEIVEILGEMI*