Scaffold NAP2_1111113

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold NAP2_1111113

Scaffold NAP2_1111113

Overview

Basic Information
Taxon OID	3300003476 Open in IMG/M
Scaffold ID	NAP2_1111113 Open in IMG/M
Source Dataset Name	Estuarine microbial communities from the Sarno estuary, Gulf of Naples, Italy - Sample Station 2
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	605
Total Scaffold Genes	3 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Associated Families	1

Taxonomy
Not Available	(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Estuarine → Estuary Microbial Community From Gulf Of Naples, Italy

Source Dataset Sampling Location
Location Name	Gulf of Naples
Coordinates	Lat. (^o)	40.725	Long. (^o)	14.39983	Alt. (m)		Depth (m)	0
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F083429	Metagenome / Metatranscriptome	113	Y

Sequences

Protein ID	Family	RBS	Sequence
NAP2_11111131	F083429	N/A	DMARRRKTTGKTTFGKAFRKKSSRGKFKKGTMIRYKYVNGRRVGAEKTRK*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.