Scaffold INDIC_1831780

Overview

Basic Information

• Taxon OID: 3300003475
• Scaffold ID: INDIC_1831780
• Source Dataset Name: Marine microbial communities from the Indian Ocean - GS112
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: J. Craig Venter Institute (JCVI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 552
• Total Scaffold Genes: 2
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 1 (50.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. TMED166 (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine → Marine Microbial Communities From Global Ocean Sampling (Gos)

Source Dataset Sampling Location

• Location Name: Indian Ocean
• Coordinates
  • Lat. (^o): -8.505
  • Long. (^o): 80.37556
  • Depth (m): 1.8

Associated Families

Family	Category	Number of Sequences	3D Structure?
F009035	Metagenome / Metatranscriptome	324	N

Sequences

Protein ID	Family	RBS	Sequence
INDIC_18317802	F009035	N/A	ILYWFSEGVTEGWTWSTKKRKETNKLIHPNNKSNGIFDYHMWRILENVGVWGTVILAFLMNASFSKFFWLGVGSWFIGTFCYEAALNHVNKGTIYKPVDYKWHILGYDIPWWGGKRIFILPAVGFVILLYGIII*