Scaffold NAP4_1104509

Overview

Basic Information

• Taxon OID: 3300003474
• Scaffold ID: NAP4_1104509
• Source Dataset Name: Estuarine microbial communities from the Sarno estuary, Gulf of Naples, Italy - Sample Station 4
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 590
• Total Scaffold Genes: 1
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Cellvibrionales → Halieaceae → Luminiphilus → Luminiphilus syltensis (Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Estuarine → Estuary Microbial Community From Gulf Of Naples, Italy

Source Dataset Sampling Location

• Location Name: Sarno river estuary, Gulf of Naples
• Coordinates
  • Lat. (^o): 40.72683
  • Long. (^o): 14.46133
  • Depth (m): 0

Associated Families

Family	Category	Number of Sequences	3D Structure?
F043260	Metagenome / Metatranscriptome	156	Y

Sequences

Protein ID	Family	RBS	Sequence
NAP4_11045091	F043260	AGG	MTKDAKYRFLSKLEQLAEELYRHGDSINHGDAWELQRSFLWGYGDAGKTINLVTSEDIQKVIDRAHERVYGESRVCRIERLKPLENESGEPDWDAFDSPTWERRQGSTKGWNSKVGVRSTKATIL*ASV