Scaffold NAP4_1024383

Overview

Basic Information

• Taxon OID: 3300003474
• Scaffold ID: NAP4_1024383
• Source Dataset Name: Estuarine microbial communities from the Sarno estuary, Gulf of Naples, Italy - Sample Station 4
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 1123
• Total Scaffold Genes: 2
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. IMCC9063 (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Estuarine → Estuary Microbial Community From Gulf Of Naples, Italy

Source Dataset Sampling Location

• Location Name: Sarno river estuary, Gulf of Naples
• Coordinates
  • Lat. (^o): 40.72683
  • Long. (^o): 14.46133
  • Depth (m): 0

Associated Families

Family	Category	Number of Sequences	3D Structure?
F001756	Metagenome / Metatranscriptome	641	Y

Sequences

Protein ID	Family	RBS	Sequence
NAP4_10243831	F001756	N/A	EPNCPCVIDKASLILELNKPRKKLCPKLEKNVKIKPNRITFKLKLLNIDKNYDL*