| Basic Information | |
|---|---|
| Taxon OID | 3300003474 Open in IMG/M |
| Scaffold ID | NAP4_1004495 Open in IMG/M |
| Source Dataset Name | Estuarine microbial communities from the Sarno estuary, Gulf of Naples, Italy - Sample Station 4 |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 2280 |
| Total Scaffold Genes | 4 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 3 (75.00%) |
| Novel Protein Genes | 2 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (50.00%) |
| Associated Families | 2 |
| Taxonomy | |
|---|---|
| All Organisms → Viruses → unclassified viruses → Virus sp. | (Source: UniRef50) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Estuarine → Estuary Microbial Community From Gulf Of Naples, Italy |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Sarno river estuary, Gulf of Naples | |||||||
| Coordinates | Lat. (o) | 40.72683 | Long. (o) | 14.46133 | Alt. (m) | Depth (m) | 0 | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F000613 | Metagenome / Metatranscriptome | 985 | Y |
| F002192 | Metagenome / Metatranscriptome | 585 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| NAP4_10044952 | F000613 | AGGAG | MPLVKKRLSIAAGATSDQVLAGTTYEYVDPGTRIVVASAVDTAGTATADTTMDFTVNNAEFSKNASVSALVTGEPFGWNGNYVMNDMVTTGQVRNRPIITFTNGTSATRTVDVAVFIGG* |
| NAP4_10044954 | F002192 | N/A | MYHVLLYCTFFIAILALFFGLYACGRVAKVQTAVKDLDWDAVANMTGDLATTKRTIQTLNNRINGMHSPKLQDQELMLQLLQQQGQQKNGKMVGG* |
| ⦗Top⦘ |