| Basic Information | |
|---|---|
| Taxon OID | 3300003465 Open in IMG/M |
| Scaffold ID | P52013CM_1034801 Open in IMG/M |
| Source Dataset Name | Ore pile and mine drainage contaminated soil microbial communities from Mina do Sossego, Brazil - P5 sample |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | University of Campinas |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 1349 |
| Total Scaffold Genes | 3 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 2 (66.67%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | (Source: UniRef50) |
| Source Dataset Ecosystem |
|---|
| Environmental → Terrestrial → Soil → Unclassified → Mine Drainage → Ore Pile And Mine Drainage Contaminated Soil → Ore Pile And Mine Drainage Contaminated Soil Microbial Communities From Mina Do Sossego, Brazil, In A Copper Mine |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Mina do Sossego, Brazil | |||||||
| Coordinates | Lat. (o) | -6.426389 | Long. (o) | -50.051389 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F070987 | Metagenome | 122 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| P52013CM_10348012 | F070987 | GAG | MADIPVSVVEPALRATVDPLAGELLARLSRQAPTRVRATRPYPRGAALELYQRKAAKGDRPGVRTDGYAAVVAALASTPEDQVIVHGVTFPDAVYLVFTDRNRRRCLGLLCKRRLSR* |
| ⦗Top⦘ |