| Basic Information | |
|---|---|
| Taxon OID | 3300003453 Open in IMG/M |
| Scaffold ID | ERB_1063349 Open in IMG/M |
| Source Dataset Name | Combined Assembly of Gp0111477, Gp0111476 |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | University of California, Davis |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 819 |
| Total Scaffold Genes | 3 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 2 (66.67%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Bacteria | (Source: IMG/M) |
| Source Dataset Ecosystem |
|---|
| Environmental → Terrestrial → Volcanic → Fumaroles → Unclassified → Volcano-Associated Fumarole → Volcano-Associated Fumarole Microbial Communities From Mt. Erebus, Antarctica, That Are Thermophilic |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Mt. Erebus, Antarctica | |||||||
| Coordinates | Lat. (o) | -77.533333 | Long. (o) | 167.116667 | Alt. (m) | Depth (m) | 0 to .02 | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F056168 | Metagenome | 138 | N |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| ERB_10633492 | F056168 | GGA | MLNQVKLIFFWLYNTVKNMTTTLSEKRQISIPKDLCDQLHIEPGARIAWEVRDHKLVGYPIPKEGWRALVGRHKGGPDLVKQLLKQRREDREREKRKLAR* |
| ⦗Top⦘ |