Scaffold ERB_1063349

Overview

Basic Information

• Taxon OID: 3300003453
• Scaffold ID: ERB_1063349
• Source Dataset Name: Combined Assembly of Gp0111477, Gp0111476
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: University of California, Davis
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 819
• Total Scaffold Genes: 3
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 2 (66.67%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria (Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Terrestrial → Volcanic → Fumaroles → Unclassified → Volcano-Associated Fumarole → Volcano-Associated Fumarole Microbial Communities From Mt. Erebus, Antarctica, That Are Thermophilic

Source Dataset Sampling Location

• Location Name: Mt. Erebus, Antarctica
• Coordinates
  • Lat. (^o): -77.533333
  • Long. (^o): 167.116667
  • Depth (m): 0 to .02

Associated Families

Family	Category	Number of Sequences	3D Structure?
F056168	Metagenome	138	N

Sequences

Protein ID	Family	RBS	Sequence
ERB_10633492	F056168	GGA	MLNQVKLIFFWLYNTVKNMTTTLSEKRQISIPKDLCDQLHIEPGARIAWEVRDHKLVGYPIPKEGWRALVGRHKGGPDLVKQLLKQRREDREREKRKLAR*