NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold JGI20214J51088_10960673

Scaffold JGI20214J51088_10960673


Overview

Basic Information
Taxon OID3300003432 Open in IMG/M
Scaffold IDJGI20214J51088_10960673 Open in IMG/M
Source Dataset NameWetland sediment microbial communities from Twitchell Island in the Sacramento Delta, sample from surface sediment Aug2011 Site B2 Bulk
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)561
Total Scaffold Genes1 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
All Organisms → cellular organisms → Bacteria → Nitrospirae → Nitrospira → Nitrospirales → Nitrospiraceae → unclassified Nitrospiraceae → Nitrospiraceae bacterium(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Wetlands → Sediment → Wetland → Microbial Community Impact On Carbon Sequestration In Managed Wetland Carbon Farming

Source Dataset Sampling Location
Location NameSacramento, California, United States
CoordinatesLat. (o)38.1072Long. (o)-121.6485Alt. (m)Depth (m)0
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F089113Metagenome109Y

Sequences

Protein IDFamilyRBSSequence
JGI20214J51088_109606731F089113N/AMDSLRIIDFSQKHFECQGKKFYVKESLGFVRYKELQKLSLEFGYSSTFQDVFNHIKEAWDYLNQVKLGEAAVTLHNVMYGIVAVDSDKYDASLRLCALFIDEEGEDPSVFDEGKMREKLNCWSEGGLDTLPFFQLAANLVPGWINVFQSISQNGLQGIKSESPQL*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.