Scaffold JGI25914J50564_10092541

Overview

Basic Information

• Taxon OID: 3300003429
• Scaffold ID: JGI25914J50564_10092541
• Source Dataset Name: Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM15.SN
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 757
• Total Scaffold Genes: 3
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 1 (33.33%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: Not Available (Source: )

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake → Freshwater Lake Microbial Communities From The Great Lakes, Usa, Analyzing Microbial Food Webs And Carbon Cycling

Source Dataset Sampling Location

• Location Name: Lake Michigan, USA
• Coordinates
  • Lat. (^o): 43.1998
  • Long. (^o): -86.5698

Associated Families

Family	Category	Number of Sequences	3D Structure?
F019831	Metagenome / Metatranscriptome	227	Y

Sequences

Protein ID	Family	RBS	Sequence
JGI25914J50564_100925412	F019831	N/A	VTVQRRTHLKQTQSLLFQQSKFDLEDSDLILEDETTFGRNRRSAEFGQVVEEELSDYVKFRLWLARQLAMAKYKEKWA*PAFSFGENKSKK*