Scaffold JGI26532J50257_10099263

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold JGI26532J50257_10099263

Scaffold JGI26532J50257_10099263

Overview

Basic Information
Taxon OID	3300003403 Open in IMG/M
Scaffold ID	JGI26532J50257_10099263 Open in IMG/M
Source Dataset Name	Wastewater bioreactor microbial communities from Cape Town, South Africa - Thiocy_cont_500_plan
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	DOE Joint Genome Institute (JGI)
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	705
Total Scaffold Genes	1 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Associated Families	1

Taxonomy
Not Available	(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Engineered → Bioremediation → Hydrocarbon → Unclassified → Unclassified → Wastewater Bioreactor → Wastewater Bioreactor Microbial Communities From Cape Town, South Africa

Source Dataset Sampling Location
Location Name	South Africa: Cape Town
Coordinates	Lat. (^o)	-33.927	Long. (^o)	18.452665	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F017165	Metagenome	242	Y

Sequences

Protein ID	Family	RBS	Sequence
JGI26532J50257_100992631	F017165	N/A	PSAIAFDEHRGLIAFSTGSRVHVIGANQWLADTFTWRPDRHRYAPSWMKQAVLTMTMIRSLVDESAAMSMIPNELLFEIFSFL*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.