Scaffold JGI26530J50255_1010689

Overview

Basic Information

• Taxon OID: 3300003401
• Scaffold ID: JGI26530J50255_1010689
• Source Dataset Name: Wastewater bioreactor microbial communities from Cape Town, South Africa - Thiocy_expt_500_plan
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 3714
• Total Scaffold Genes: 8
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 1 (12.50%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → Rhodanobacteraceae → Rhodanobacter (Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem: Engineered → Bioremediation → Hydrocarbon → Unclassified → Unclassified → Wastewater Bioreactor → Wastewater Bioreactor Microbial Communities From Cape Town, South Africa

Source Dataset Sampling Location

• Location Name: South Africa: Cape Town
• Coordinates
  • Lat. (^o): -33.927
  • Long. (^o): 18.452665

Associated Families

Family	Category	Number of Sequences	3D Structure?
F033870	Metagenome / Metatranscriptome	176	Y

Sequences

Protein ID	Family	RBS	Sequence
JGI26530J50255_10106891	F033870	AGGA	MKVSMEAPQTPQHDLVAMTAALRGVLLQRVEHGIQSSGLTNYFFYLVAKRLTFAGPLTIPGLAEQLRLNPRDIEDSLHVMLERGMVTREDDAWRITDTGRRALTAANNSGEQVLDDIRNAIGAAACDHLVTGMRDALAALRKAA*