| Basic Information | |
|---|---|
| Taxon OID | 3300003393 Open in IMG/M |
| Scaffold ID | JGI25909J50240_1052186 Open in IMG/M |
| Source Dataset Name | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.DD |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 848 |
| Total Scaffold Genes | 4 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 3 (75.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| Not Available | (Source: ) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake → Freshwater Lake Microbial Communities From The Great Lakes, Usa, Analyzing Microbial Food Webs And Carbon Cycling |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Lake Michigan, USA | |||||||
| Coordinates | Lat. (o) | 43.1998 | Long. (o) | -86.5698 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F048959 | Metagenome / Metatranscriptome | 147 | N |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| JGI25909J50240_10521864 | F048959 | GGA | LRKNEPTLEVTITLTELRAVIKSLSIGVDQLAKXINRLGDDKRANETFTEFADLMSAKKEMEEVLLAALQGE* |
| ⦗Top⦘ |