Scaffold JGI26338J50219_1022722

Overview

Basic Information

• Taxon OID: 3300003367
• Scaffold ID: JGI26338J50219_1022722
• Source Dataset Name: Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP03_OM3
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 554
• Total Scaffold Genes: 1
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces → unclassified Streptomyces → Streptomyces sp. CNT372 (Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil → Bog Forest Soil Microbial Communities From Calvert Island, British Columbia, Canada

Source Dataset Sampling Location

• Location Name: Calvert Island, British Columbia, Canada
• Coordinates
  • Lat. (^o): 51.62
  • Long. (^o): -128.09

Associated Families

Family	Category	Number of Sequences	3D Structure?
F051024	Metagenome	144	Y

Sequences

Protein ID	Family	RBS	Sequence
JGI26338J50219_10227221	F051024	N/A	YWLASGRSRELPWRRMLAVAGLIALGVGLNGWFLLPDFSYAHDTIISGERVSWAQAKILSTFGVIFDPLRTVPSESWLPALYVQAPVVALVWGLLAAPLSWRYRRLRAGVITALIMLVGLLVLILSPSAWSLLPNLFQHAQFTYRLQTYVTLACAGLVLVGVLALTRRARSGRATRVDRALALG