NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold JGI26345J50200_1000281

Scaffold JGI26345J50200_1000281


Overview

Basic Information
Taxon OID3300003352 Open in IMG/M
Scaffold IDJGI26345J50200_1000281 Open in IMG/M
Source Dataset NameBog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP14_OM1
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)4006
Total Scaffold Genes6 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)5 (83.33%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (100.00%)
Associated Families2

Taxonomy
All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia(Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil → Bog Forest Soil Microbial Communities From Calvert Island, British Columbia, Canada

Source Dataset Sampling Location
Location NameCalvert Island, British Columbia, Canada
CoordinatesLat. (o)51.62Long. (o)-128.09Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F000169Metagenome / Metatranscriptome1788Y
F018213Metagenome / Metatranscriptome236Y

Sequences

Protein IDFamilyRBSSequence
JGI26345J50200_10002813F000169GGAGGMAKKSKLTQVAAKVGGALGKADRKAHKVVEAGSLAKEELEAIAKQVGILKRQLEKATKRLKHAIS*
JGI26345J50200_10002815F018213GGAGGMIAMLHFATLVVTTIFAAVAAVGLNSMLLKAMFVLMRLATARRVAAPTRLAHGTAQLARAYAAQR*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.