NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold JGI25857J50181_10150

Scaffold JGI25857J50181_10150


Overview

Basic Information
Taxon OID3300003344 Open in IMG/M
Scaffold IDJGI25857J50181_10150 Open in IMG/M
Source Dataset NameUpper troposphere microbial communities - SEAC4RS-RF7-005
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)779
Total Scaffold Genes2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Air → Outdoor Air → Unclassified → Unclassified → Upper Troposphere → Upper Troposphere Microbial Communities Above Oceans And Continental Usa That Affect Ice Or Cloud Condensation Nuclei

Source Dataset Sampling Location
Location NameUSA and various oceans
CoordinatesLat. (o)Long. (o)Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F045749Metagenome / Metatranscriptome152Y

Sequences

Protein IDFamilyRBSSequence
JGI25857J50181_101502F045749N/AYFGGRDEAGEYFENLFRELELHAGAIKTFILNHTISEDFKPSGRAPDTVSRRLMIQXSVSPEQSLVEDLINKHECGVVNGRILDVTWFKSLCEGEGDVLPQSRTLAHILNDMGYQQITGRRIKIKKTRENHYIWFKAKKGVDEESVKNEVQDFFGNDLDQVPF*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.