Scaffold JGI25841J50177_100378

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold JGI25841J50177_100378

Scaffold JGI25841J50177_100378

Overview

Basic Information
Taxon OID	3300003341 Open in IMG/M
Scaffold ID	JGI25841J50177_100378 Open in IMG/M
Source Dataset Name	Upper troposphere microbial communities from Midwestern USA - DC3-114
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	DOE Joint Genome Institute (JGI)
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	612
Total Scaffold Genes	1 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Associated Families	1

Taxonomy
Not Available	(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Air → Outdoor Air → Unclassified → Unclassified → Upper Troposphere → Upper Troposphere Microbial Communities Above Oceans And Continental Usa That Affect Ice Or Cloud Condensation Nuclei

Source Dataset Sampling Location
Location Name	Midwestern USA
Coordinates	Lat. (^o)		Long. (^o)		Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F045749	Metagenome / Metatranscriptome	152	Y

Sequences

Protein ID	Family	RBS	Sequence
JGI25841J50177_1003781	F045749	N/A	ESELFDYFGGRDEAGEYFENLFRESELHAGAIKTFILNHTISEDFKPSGRAPDTVSRRLMIQASVSPEQSLVEDLINKHECGVVNGRILDVTWFKSLCXGEGDVLPQSRTLAHILNDXGYQQITGRRXKIKKTRENHYIWFKAKKGVDEESVKNEVQDFFGNDLDQVPF*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.