Scaffold GBSed_10076330

Overview

Basic Information

• Taxon OID: 3300003332
• Scaffold ID: GBSed_10076330
• Source Dataset Name: Marine hydrothermal vent sediment microbial communities from Guaymas Basin, Gulf of California - Sample 1
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 1054
• Total Scaffold Genes: 2
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 1 (50.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Hydrothermal Vents → Sediment → Marine Hydrothermal Vent Sediment → Marine Hydrothermal Vent Sediment Microbial Communities From Guaymas Basin, Gulf Of California

Source Dataset Sampling Location

• Location Name: Guyams Basin, Gulf of California, Pacific Ocean
• Coordinates
  • Lat. (^o): 27.01
  • Long. (^o): -111.43
  • Depth (m): 2000

Associated Families

Family	Category	Number of Sequences	3D Structure?
F029929	Metagenome	187	Y

Sequences

Protein ID	Family	RBS	Sequence
GBSed_100763302	F029929	N/A	LPVFQRSVDAELYQWLLKEQRRRKARSVQEVIRQILFEVKAKMEAEGHG*