NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0006574J49614_1041637

Scaffold Ga0006574J49614_1041637


Overview

Basic Information
Taxon OID3300003327 Open in IMG/M
Scaffold IDGa0006574J49614_1041637 Open in IMG/M
Source Dataset NameIonic liquid and high solid enriched microbial communities from the Joint BioEnergy Institute, USA - AR20-4-R (Metagenome Metatranscriptome, Counting Only)
Source Dataset CategoryMetatranscriptome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)510
Total Scaffold Genes1 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Engineered → Lab Enrichment → Defined Media → Unclassified → Unclassified → Ionic Liquid And High Solid Enriched → Ionic Liquid And High Solid Enriched Microbial Communities From The Joint Bioenergy Institute, California, Usa

Source Dataset Sampling Location
Location NameJoint BioEnergy Institute, California, USA
CoordinatesLat. (o)38.5402Long. (o)-121.75Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F003289Metagenome / Metatranscriptome495Y

Sequences

Protein IDFamilyRBSSequence
Ga0006574J49614_10416371F003289N/AILIHLTQ*QY*W*F*FSFLWAFYYLTILKIVRFRTLKFRPRIATTLRPHGK*GDLIICIIPVS*CANIISNSNFILRMIE*QSEASLLTVRIRGKQWY*VYKFELKTFTDVLTVPKNIGRNK*QISTPGDLQVADDYLHILQLRAQNK*VKNY*SDMVKKTSKTKNFHLI

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.