Scaffold soilH2_10152629

Overview

Basic Information

• Taxon OID: 3300003324
• Scaffold ID: soilH2_10152629
• Source Dataset Name: Sugarcane bulk soil Sample H2
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 3852
• Total Scaffold Genes: 5
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 3 (60.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales (Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Sugarcane Root And Bulk Soil → Sugarcane Root And Bulk Soil Microbial Communities From Ayr, Burdekin, Queensland Australia

Source Dataset Sampling Location

• Location Name: Ayr, Queensland Australia
• Coordinates
  • Lat. (^o): -19.733298
  • Long. (^o): 147.17873

Associated Families

Family	Category	Number of Sequences	3D Structure?
F020050	Metagenome / Metatranscriptome	226	Y

Sequences

Protein ID	Family	RBS	Sequence
soilH2_101526294	F020050	AGGGGG	MPELRSVSPLELTPQQTEALRQLAHFGAMDAAHSLGRLLGTFVDVSPPRVQVAPKGAIHQVLQPDGAAFAVHFEVDGGAHMRWMMYVTQEGATLMGGLLLGSAGAVAGKPTLYTSALAEMSNIVVSSYVGGVAAAVGLTLVPSIPHVGKGTLSDTLQAAFGDLDSTLLLVTDLRLPGVRLAGRIVAAPIEDSLSRLLSMLGAV*