Scaffold rootH1_10117698

Overview

Basic Information

• Taxon OID: 3300003323
• Scaffold ID: rootH1_10117698
• Source Dataset Name: Sugarcane root Sample H1
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 1957
• Total Scaffold Genes: 3
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 1 (33.33%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae → Variovorax → Variovorax paradoxus (Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem: Host-Associated → Plants → Rhizome → Unclassified → Unclassified → Sugarcane Root And Bulk Soil → Sugarcane Root And Bulk Soil Microbial Communities From Ayr, Burdekin, Queensland Australia

Source Dataset Sampling Location

• Location Name: Ayr, Queensland Australia
• Coordinates
  • Lat. (^o): -19.733298
  • Long. (^o): 147.17873

Associated Families

Family	Category	Number of Sequences	3D Structure?
F049749	Metagenome	146	Y

Sequences

Protein ID	Family	RBS	Sequence
rootH1_101176982	F049749	GAGG	MMFFGRKRPSVRLVRAWCSPFGEDGPAGELLALVDEVLASTALQPLEGQINFGYTQPMSSLRRALAKMKPVALDALTVQDEAGDVICSFGAESASVGDRVRAFEIFALLPPASDPAQDKLLRLLMRHGMHYGYARALGAARDPVTEAPRKRGFFDPTIEVAGGRADWLVPEMDVRAGAVRGLYPLNVFSAVGLARLAGSGLRLPPSAPTLGDQLWRPTVIEQSELLRTNPSYRGFLHFGDD*