NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold soilH1_10336806

Scaffold soilH1_10336806


Overview

Basic Information
Taxon OID3300003321 Open in IMG/M
Scaffold IDsoilH1_10336806 Open in IMG/M
Source Dataset NameSugarcane bulk soil Sample H1
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing Center
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1249
Total Scaffold Genes3 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)2 (66.67%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (100.00%)
Associated Families1

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Sugarcane Root And Bulk Soil → Sugarcane Root And Bulk Soil Microbial Communities From Ayr, Burdekin, Queensland Australia

Source Dataset Sampling Location
Location NameAyr, Queensland Australia
CoordinatesLat. (o)-19.733298Long. (o)147.17873Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F022454Metagenome / Metatranscriptome214Y

Sequences

Protein IDFamilyRBSSequence
soilH1_103368062F022454AGGMSYYSSFVVEKIGIHRGFAVETVLQNVTDTVMSHVTKIQTTLYDLVATLQAELSPDEDNLVIATVVHLLQTHQVTCTGALQGYRLACTGRAHLAQLLPSGYGCPSQFESYVNHCERPRKVIP*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.