| Basic Information | |
|---|---|
| Taxon OID | 3300003321 Open in IMG/M |
| Scaffold ID | soilH1_10074853 Open in IMG/M |
| Source Dataset Name | Sugarcane bulk soil Sample H1 |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 1908 |
| Total Scaffold Genes | 2 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (50.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Bacteria → Acidobacteria | (Source: UniRef50) |
| Source Dataset Ecosystem |
|---|
| Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Sugarcane Root And Bulk Soil → Sugarcane Root And Bulk Soil Microbial Communities From Ayr, Burdekin, Queensland Australia |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Ayr, Queensland Australia | |||||||
| Coordinates | Lat. (o) | -19.733298 | Long. (o) | 147.17873 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F033944 | Metagenome | 176 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| soilH1_100748532 | F033944 | N/A | EIRRSLPFDSTPLRMGLHITIAVLAGLAALWAVNVPHHSFTGVMRQLIAIAVLTYLFIVVRRARSKRRADSEHVNGVLIAPCETSAKITAYDEQGRTPVERVFKS* |
| ⦗Top⦘ |