Scaffold rootH2_10267993

Overview

Basic Information

• Taxon OID: 3300003320
• Scaffold ID: rootH2_10267993
• Source Dataset Name: Sugarcane root Sample H2
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 1121
• Total Scaffold Genes: 2
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 65-7 (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Host-Associated → Plants → Rhizome → Unclassified → Unclassified → Sugarcane Root And Bulk Soil → Sugarcane Root And Bulk Soil Microbial Communities From Ayr, Burdekin, Queensland Australia

Source Dataset Sampling Location

• Location Name: Ayr, Queensland Australia
• Coordinates
  • Lat. (^o): -19.733298
  • Long. (^o): 147.17873

Associated Families

Family	Category	Number of Sequences	3D Structure?
F060010	Metagenome	133	Y

Sequences

Protein ID	Family	RBS	Sequence
rootH2_102679931	F060010	N/A	MERPYRMAAPEPRWPWLQTGFRIAFTAVLVYGFFSGSSFLSFGIAAVLGISCALAVLLGYELAIRDVSSRWTAGCIIVLVGTSLVGYGAWLATRPPVPTGPLLPAGESTPHAACVEKLGPEGLVMAFGTDRAVGTGSGPFQPITVGDCTVMALRRVGQGLMIKAFFYDWNGDVAFGVNDNKYEPTLPLQLRSFRPDPHTFVILDRFDKEVLYVRYLNPNAVRIRGRFLCGTAPQAVIRDDMILVGGMRISGAYFGQRRAGGHVCAVLPPGGEGIAIGAH*