Scaffold soilL2_10086839

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold soilL2_10086839

Scaffold soilL2_10086839

Overview

Basic Information
Taxon OID	3300003319 Open in IMG/M
Scaffold ID	soilL2_10086839 Open in IMG/M
Source Dataset Name	Sugarcane bulk soil Sample L2
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	7209
Total Scaffold Genes	11 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	3 (27.27%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Associated Families	1

Taxonomy
All Organisms → cellular organisms → Bacteria	(Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Sugarcane Root And Bulk Soil → Sugarcane Root And Bulk Soil Microbial Communities From Ayr, Burdekin, Queensland Australia

Source Dataset Sampling Location
Location Name	Ayr, Queensland Australia
Coordinates	Lat. (^o)	-19.733298	Long. (^o)	147.17873	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F065577	Metagenome / Metatranscriptome	127	Y

Sequences

Protein ID	Family	RBS	Sequence
soilL2_1008683911	F065577	N/A	AIPMLWAALGMIRPPASDATVLGAVLADSGSVRRRVIWRFAQLGDMLDYLATDSAGRTVRLEAEWWRRGKRVARSRTSLDARERPASARVDFPSEGARFELTVVAIDTATVVAPALWRSRR*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.