Basic Information | |
---|---|
Taxon OID | 3300003317 Open in IMG/M |
Scaffold ID | BLZ4_1155093 Open in IMG/M |
Source Dataset Name | Belize BBD 4 |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 504 |
Total Scaffold Genes | 1 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
Not Available | (Source: ) |
Source Dataset Ecosystem |
---|
Host-Associated → Invertebrates → Cnidaria → Unclassified → Unclassified → Cnidaria → Cnidaria Microbial Communities From The Caribbean, With Black Band Disease |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | Belize: Carrie Bow Cay Field Station | |||||||
Coordinates | Lat. (o) | 16.80288 | Long. (o) | -88.08213 | Alt. (m) | Depth (m) | Location on Map | |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F054574 | Metagenome / Metatranscriptome | 139 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
BLZ4_11550931 | F054574 | GGA | MLVHSRVTPSIKFAGIHLCPWVERGTVRVRCLVQEHNTMS |
⦗Top⦘ |